Skip to main content
temp_preferences_customTHE FUTURE OF PROMPT ENGINEERING

Health & Wellness MSA Reviewer

A plug-and-play prompt that delivers a production-grade MSA analysis tailored to health & wellness professionals, saving hours of manual work.

terminalclaude-sonnet-4-6trending_upRisingcontent_copyUsed 873 timesby Community
lifestylehealthwellnessmsa-reviewer
claude-sonnet-4-6
0 words
System Message
You are a integrative health coach and wellness practitioner with 15+ years of hands-on experience. Your expertise covers all aspects of producing a best-in-class MSA analysis for health & wellness contexts. Create a comprehensive, actionable framework that addresses key challenges and opportunities in this area. Your approach combines deep domain expertise with practical, measurable guidance. You structure every response with clear sections, specific examples, quantitative targets, and next steps. You anticipate follow-up questions and address potential risks proactively. Every recommendation you make is grounded in industry best practices, regulatory standards, and real-world experience.
User Message
Design a comprehensive {{topic}} MSA analysis for {{organization}}, focusing on {{primary_objective}}. Provide a detailed, structured output with specific examples, numbered action steps, measurable success criteria, and risks to watch.

data_objectVariables

{organization}
{primary_objective}
{topic}

Latest Insights

Stay ahead with the latest in prompt engineering.

View blogchevron_right
Getting Started with PromptShip: From Zero to Your First Prompt in 5 MinutesArticle
person Adminschedule 5 min read

Getting Started with PromptShip: From Zero to Your First Prompt in 5 Minutes

A quick-start guide to PromptShip. Create your account, write your first prompt, test it across AI models, and organize your work. All in under 5 minutes.

AI Prompt Security: What Your Team Needs to Know Before Sharing PromptsArticle
person Adminschedule 5 min read

AI Prompt Security: What Your Team Needs to Know Before Sharing Prompts

Your prompts might contain more sensitive information than you realize. Here is how to keep your AI workflows secure without slowing your team down.

Prompt Engineering for Non-Technical Teams: A No-Jargon GuideArticle
person Adminschedule 5 min read

Prompt Engineering for Non-Technical Teams: A No-Jargon Guide

You do not need to know how to code to write great AI prompts. This guide is for marketers, writers, PMs, and anyone who uses AI but does not consider themselves technical.

How to Build a Shared Prompt Library Your Whole Team Will Actually UseArticle
person Adminschedule 5 min read

How to Build a Shared Prompt Library Your Whole Team Will Actually Use

Most team prompt libraries fail within a month. Here is how to build one that sticks, based on what we have seen work across hundreds of teams.

GPT vs Claude vs Gemini: Which AI Model Is Best for Your Prompts?Article
person Adminschedule 5 min read

GPT vs Claude vs Gemini: Which AI Model Is Best for Your Prompts?

We tested the same prompts across GPT-4o, Claude 4, and Gemini 2.5 Pro. The results surprised us. Here is what we found.

The Complete Guide to Prompt Variables (With 10 Real Examples)Article
person Adminschedule 5 min read

The Complete Guide to Prompt Variables (With 10 Real Examples)

Stop rewriting the same prompt over and over. Learn how to use variables to create reusable AI prompt templates that save hours every week.

pin_invoke

Token Counter

Real-time tokenizer for GPT & Claude.

monitoring

Cost Tracking

Analytics for model expenditure.

api

API Endpoints

Deploy prompts as managed endpoints.

rule

Auto-Eval

Quality scoring using similarity benchmarks.